PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00097409001
Common NameGSBRNA2T00097409001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 272aa    MW: 31360.4 Da    PI: 8.9578
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00097409001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.12.6e-3585140257
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57 
                          ++k+l+cprC+s++tkfCyynny+++qPr+fC++C+ryWt GG++r vPvG+g+ k
  GSBRNA2T00097409001  85 PDKILPCPRCKSSDTKFCYYNNYNVTQPRHFCRSCQRYWTSGGSMRTVPVGSGQNK 140
                          7899*************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2681140IPR003851Zinc finger, Dof-type
PfamPF027011.0E-2987140IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.80489143IPR003851Zinc finger, Dof-type
PROSITE patternPS01361091127IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MPRGCICICI VVLKEIREPN PKTRSDKNEF EPIQTWHKYR MNLVLWYFGQ HKSEGSKETS  60
ENSEITTTTT TTASEEKTTD DLKKPDKILP CPRCKSSDTK FCYYNNYNVT QPRHFCRSCQ  120
RYWTSGGSMR TVPVGSGQNK GWVSSDHYMH IKSENTNNYN DASAKILSFD SSGDESLVTE  180
NGKNQSSDSI SKNFNNFQRF LPPQVTSSVS RPWPYQYPHI PTFYHIPVYW GCTVPFWSTL  240
QTYTCTHISQ HHIMHTHKKK KKTLLCLILG M*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584449.11e-105PREDICTED: dof zinc finger protein DOF1.3
SwissprotQ9LQX43e-88DOF13_ARATH; Dof zinc finger protein DOF1.3
TrEMBLA0A078IMU40.0A0A078IMU4_BRANA; BnaC05g50970D protein
STRINGBra024683.1-P9e-94(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140821624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26790.13e-81Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]